BigMeat525 BigMeat525

11-01-2024
Mathematics

contestada

alex can complete 1/20th of a piece of work in two days. how many days will it take to alex to complete the entire work?

Respuesta :

Otras preguntas

1 3 5 × 1 1 3 = 8 5 × 4 3 = Find the product of the mixed numbers. Choose the correct answer. StartFraction 4 Over 5 EndFraction 1 and StartFracti

7.They grow when girls become up?

If the forces on an object are balanced, the object will do what?

someone please answer!

Which answer supports the statement, "The state constitution is more detailed than the U.S. Constitution"? A) The U.S. Constitution was created after state cons

I have a test in biology 9th grade, it’s about organ system and how the orange work together. How do I explain ?

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

using the venn diagram below compare and contrast media literacy information literacy and technology literacy give at least three similarities and differences

Can anybody help me please? My first article if: It is important to me because ... My article shows that I..

Are humans made of matter